*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Zinc/RING finger protein 3(ZNRF3),Partial

As low as $378.00
In stock
Product Code
CSB-EP890933HUe1
Product Code: CSB-EP890933HUe1
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. Q9ULT6
Target/Protein ZNRF3
Species of origin Homo sapiens (Human)
AA Sequence KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
Protein description Partial
MW of Fusion Proten 18.2 kDa
Expression Region 56-219aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info Tag-Free
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Zinc/RING finger protein 3(ZNRF3),Partial
Your Rating