* Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon.
* The information on this page is not updated. For the latest product information, please search on cusabio.com with the product code.

Recombinant Human E3 ubiquitin-protein ligase ZNRF3(ZNRF3),partial

As low as $317.00
In stock
Product Code
CSB-BP890933HU
Product Code: CSB-BP890933HU
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: Insect Baculovirus
More Information
Uniprot NO. Q9ULT6
Target/Protein ZNRF3
Species of origin Homo sapiens (Human)
AA Sequence KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
Protein description Partial
MW of Fusion Proten 23.8 kDa
Expression Region 56-219aa
Expression System Insect Baculovirus
Purity Greater than 90% as determined by SDS-PAGE.
Tag info C-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human E3 ubiquitin-protein ligase ZNRF3(ZNRF3),partial
Your Rating