Recombinant Vaccinia virus Protein I5(VACWR074)

$959.00
In stock
Product Code
CSB-CF318298VAI
Product Inquiry
Product Code: CSB-CF318298VAI
Size: 10μg/50μg/100μg
Species of origin: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Application: SDS-PAGE
Express system: in vitro E.coli
More Information
Alternative names Protein VP13K
Uniprot NO. P12924
Species of origin Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
AA Sequence VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS
Biologically Active Not Test
Nature Recombinant
Protein length Full Length
MW of Fusion Proten 24.6
Expression Region 2-79aa
Expression System In vitro E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-SUMO-tagged
Buffer Tris-based buffer, 50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Relevance Envelope proteinreference="Sequence and transcriptional analysis of the vaccinia virus HindIII I fragment."Schmitt J.F.C., Stunnenberg H.G.J. Virol. 62:1889-1897(1988)
Research areas Others

Write Your Own Review
You're reviewing:Recombinant Vaccinia virus Protein I5(VACWR074)
Your Rating