Recombinant Macaca fascicularis Transthyretin(TTR)

$275.00
In stock
Product Code
CSB-MP025270MOV
Product Inquiry
Product Code: CSB-MP025270MOV
Size: 10μg/50μg/100μg/200μg
Species of origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Application: SDS-PAGE
Express system: Mammalian cell
More Information
Alternative names Prealbumin
Uniprot NO. Q8HXW1
Target/Protein TTR
Species of origin Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
AA Sequence GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE
Biologically Active Not Test
Nature Recombinant
Protein description Full Length of Mature Protein
MW of Fusion Proten 17.7 kDa
Expression Region 21-147aa
Expression System Mammalian Cell
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "Isolation and characterization of cDNA for macaque neurological disease genes."Kusuda J., Osada N., Hida M., Sugano S., Hashimoto K. Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
Relevance Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).
Research areas Cardiovascular

Write Your Own Review
You're reviewing:Recombinant Macaca fascicularis Transthyretin(TTR)
Your Rating