Recombinant Human Thymic stromal lymphopoietin(TSLP)

$275.00
In stock
Product Code
CSB-MP025141HU
Product Inquiry
Product Code: CSB-MP025141HU
Size: 10μg/50μg/100μg/200μg
Species of origin: Homo sapiens (Human)
Application: SDS-PAGE
Express system: Mammalian cell
More Information
Uniprot NO. Q969D9
Target/Protein TSLP
Species of origin Homo sapiens (Human)
AA Sequence YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Biologically Active Not Test
Nature Recombinant
Protein description Full Length of Mature Protein
MW of Fusion Proten 18.9 kDa
Expression Region 29-159aa
Expression System Mammalian Cell
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "Cloning of human thymic stromal lymphopoietin (TSLP) and signaling mechanisms leading to proliferation."Quentmeier H., Drexler H.G., Fleckenstein D., Zaborski M., Armstrong A., Sims J.E., Lyman S.D.Leukemia 15:1286-1292(2001)
Relevance Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells. Isoform 2: May act as an antimicrobial peptide in the oral cavity and on the skin.
Research areas Immunology

Write Your Own Review
You're reviewing:Recombinant Human Thymic stromal lymphopoietin(TSLP)
Your Rating