*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial

As low as $396.00
In stock
Product Code
CSB-MP023991HU
Product Code: CSB-MP023991HU
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: Mammalian cell
More Information
Uniprot NO. O43557
Target/Protein TNFSF14
Species of origin Homo sapiens (Human)
AA Sequence DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Protein description Partial
MW of Fusion Proten 48.3
Expression Region 74-240aa
Expression System Mammalian Cell
Purity Greater than 90% as determined by SDS-PAGE.
Tag info C-terminal hFc-Myc-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial
Your Rating