Recombinant Human Tumor necrosis factor ligand superfamily member 12(TNFSF12),partial

As low as $212.00
In stock
Product Code
CSB-EP023987HU
Product Code: CSB-EP023987HU
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. O43508
Target/Protein TNFSF12
Species of origin Homo sapiens (Human)
AA Sequence SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Protein description Extracellular Domain
MW of Fusion Proten 38.9 kDa
Expression Region 43-249aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-SUMO-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Tumor necrosis factor ligand superfamily member 12(TNFSF12),partial
Your Rating