*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon
Alternative names | CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA |
---|---|
Uniprot NO. | Q07011 |
Target/Protein | TNFRSF9 |
Species of origin | Homo sapiens (Human) |
AA Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
Activity Data | The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml. |
Protein description | Extracellular Domain |
MW of Fusion Proten | 18.1 kDa |
Expression Region | 24-186aa |
Expression System | Mammalian Cell |
Purity | Greater than 95% as determined by SDS-PAGE. |
Tag info | C-terminal 6xHis-tagged |
Storage | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Relevance | Tumor necrosis factor receptor superfamily member 9(TNFRSF9), also known as CD137 and 4-1BB, is an inducible T cell surface protein belonging to the tumor necrosis factor receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. CD137 is expressed by mesenchymal cells, including endothelial cells, chondrocytes, and cells of the central nervous system. CD137 is also broadly expressed by cells of the human immune system, is broadly expressed by cells of the human immune system, including activated CD8+ and CD4+ T cells, activated natural killer (NK) cells, follicular dendritic cells (FDCs) and monocytes. CD137 has diverse roles in the immune response, the one key function is to promote the survival of both T cells and dendritic cells by binding the cognate ligand CD137L (4-1BBL). |
Research areas | Cancer |