* Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon.
* The information on this page is not updated. For the latest product information, please search on cusabio.com with the product code.

Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial

As low as $78.00
In stock
Product Code
CSB-AP005141HU
Product Code: CSB-AP005141HU
Size: 10μg/50μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Express system: Mammalian Cell
More Information
Alternative names CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA
Uniprot NO. Q07011
Target/Protein TNFRSF9
Species of origin Homo sapiens (Human)
AA Sequence LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Activity Data The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml.
Protein description Extracellular Domain
MW of Fusion Proten 18.1 kDa
Expression Region 24-186aa
Expression System Mammalian Cell
Purity Greater than 95% as determined by SDS-PAGE.
Tag info C-terminal 6xHis-tagged
Storage Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Relevance Tumor necrosis factor receptor superfamily member 9(TNFRSF9), also known as CD137 and 4-1BB, is an inducible T cell surface protein belonging to the tumor necrosis factor receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. CD137 is expressed by mesenchymal cells, including endothelial cells, chondrocytes, and cells of the central nervous system. CD137 is also broadly expressed by cells of the human immune system, is broadly expressed by cells of the human immune system, including activated CD8+ and CD4+ T cells, activated natural killer (NK) cells, follicular dendritic cells (FDCs) and monocytes. CD137 has diverse roles in the immune response, the one key function is to promote the survival of both T cells and dendritic cells by binding the cognate ligand CD137L (4-1BBL).
Research areas Cancer

Write Your Own Review
You're reviewing:Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial
Your Rating