Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial -Cusabio

More Information
Alternative names	CD137;ILA;TNFRSF9;4-1BB ligand receptor;CDw137;T-cell antigen 4-1BB homolog;T-cell antigen ILA
Uniprot NO.	Q07011
Target/Protein	TNFRSF9
Species of origin	Homo sapiens (Human)
AA Sequence	LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Activity Data	The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml.
Protein description	Extracellular Domain
MW of Fusion Proten	44 kDa
Expression Region	24-186aa
Expression System	Mammalian Cell
Purity	Greater than 95% as determined by SDS-PAGE.
Tag info	C-terminal 6xHis-FC-tagged
Storage	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Relevance	Tumor necrosis factor receptor superfamily member 9(TNFRSF9) is an inducible T cell surface protein belonging to the TNF receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. It is absent from naive T cells, but upregulated and continually expressed following T cell activation. It is a receptor for TNFSF9/4-1BBL, and possibly active during T cell activation.
Research areas	Cancer

Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial