Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial

As low as $137.00
In stock
Product Code
CSB-AP004971HU
Product Code: CSB-AP004971HU
Size: 10μg/50μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Express system: E.coli
More Information
Alternative names Tumor necrosis factor receptor superfamily member 1A;Tumor necrosis factor receptor 1;TNF-R1;Tumor necrosis factor receptor type I;TNF-RI;TNFR-I;TNFAR; TNFR1
Uniprot NO. P19438
Target/Protein TNFRSF1A
Species of origin Homo sapiens (Human)
AA Sequence IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Activity Data The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L?929 mouse fibroblast cells is less than 500 ng/ml in the presence of the metabolic inhibitor actinomycin D.?
Protein description Partial
MW of Fusion Proten 23.5 kDa
Expression Region 22-211aa
Expression System E.coli
Purity Greater than 95% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Storage Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Relevance Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) is a member of the tumor necrosis factor receptor superfamily. Tnfrsf1a is one of the major receptors for the tumor necrosis factor-alpha. It can activate the transcription factor NF-κB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the human genetic disorder called tumor necrosis factor associated periodic syndrome (TRAPS) or periodic fever syndrome
Research areas Cancer

Write Your Own Review
You're reviewing:Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial
Your Rating