Recombinant Human Transforming growth factor beta-3(TGFB3),Partial

$195.00
In stock
Product Code
CSB-AP004051HU
Product Inquiry
Product Code: CSB-AP004051HU
Size: 10μg/50μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Express system: Mammalian cell
More Information
Alternative names Transforming growth factor beta-3;TGFB3;TGF-beta-3;Latency-associated peptide;LAP
Uniprot NO. P10600
Target/Protein TGFB3
Species of origin Homo sapiens (Human)
AA Sequence ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Activity Data The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T?cells is less than 2 ng/ml.
Protein description Partial
MW of Fusion Proten 12.7 kDa
Expression Region 301-412aa(Y340F)
Expression System Mammalian Cell
Purity Greater than 95% as determined by SDS-PAGE.
Tag info Tag-Free
Storage Lyophilized from a 0.2 μm Filtered 4 mM HCl
Relevance Transforming growth factor beta 3(TGFB3) is a member of a TGF -β superfamily which is defined by theirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset ofintegrins. It binds with high affinity to TGF- β RII, a type II serine/threonine kinase receptor. TGFB3 is involved incell differentiation, embryogenesis and development.It is believed to regulate molecules involved in cellularadhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF-β3,mammals develop a deformity known as a cleft palate.
Research areas Cancer

Write Your Own Review
You're reviewing:Recombinant Human Transforming growth factor beta-3(TGFB3),Partial
Your Rating