Recombinant Human Gamma-synuclein(SNCG)

As low as $212.00
In stock
Product Code
CSB-EP021915HU
Product Code: CSB-EP021915HU
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. O76070
Target/Protein SNCG
Species of origin Homo sapiens (Human)
AA Sequence MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Protein description Full Length
MW of Fusion Proten 29.3 kDa
Expression Region 1-127aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-SUMO-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Gamma-synuclein(SNCG)
Your Rating