Recombinant Human Sodium/glucose cotransporter 2(SLC5A2), partial

$196.00
In stock
Product Code
CSB-EP021679HU1
Product Inquiry
Product Code: CSB-EP021679HU1
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Application: SDS-PAGE
Express system: E.coli
More Information
Alternative names Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2
Uniprot NO. P31639
Target/Protein SLC5A2
Species of origin Homo sapiens (Human)
AA Sequence MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Biologically Active Not Test
Nature Recombinant
Protein description Partial
MW of Fusion Proten 15.5 kDa
Expression Region 1-102aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "Thioglycosides as inhibitors of hSGLT1 and hSGLT2: potential therapeutic agents for the control of hyperglycemia in diabetes." Castaneda F., Burse A., Boland W., Kinne R.K. Int J Med Sci 4:131-139(2007)
Relevance Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules
Research areas Signal Transduction

Write Your Own Review
You're reviewing:Recombinant Human Sodium/glucose cotransporter 2(SLC5A2), partial
Your Rating