*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1(SLC2A1),partial

As low as $306.00
In stock
Product Code
CSB-EP021546HU
Product Code: CSB-EP021546HU
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. P11166
Target/Protein SLC2A1
Species of origin Homo sapiens (Human)
AA Sequence CPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQP
Protein description Partial
MW of Fusion Proten 15.2 kDa
Expression Region 207-271aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1(SLC2A1),partial
Your Rating