* Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon.
* The information on this page is not updated. For the latest product information, please search on cusabio.com with the product code.

Recombinant Mouse Serine protease inhibitor A3N(Serpina3n)

As low as $235.00
In stock
Product Code
CSB-EP835578MO
Product Code: CSB-EP835578MO
Size: 10μg/200μg
Species: Mus musculus (Mouse)
Express system: E.coli
More Information
Alternative names Spi2
Uniprot NO. Q91WP6
Target/Protein Serpina3n
Species of origin Mus musculus (Mouse)
AA Sequence FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK
Protein description Full length of mature protein
MW of Fusion Proten 60.8 kDa
Expression Region 21-418aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-SUMO-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Mouse Serine protease inhibitor A3N(Serpina3n)
Your Rating