*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Protein SCO2 homolog, mitochondrial(SCO2)

As low as $212.00
In stock
Product Code
CSB-EP020853HU
Product Code: CSB-EP020853HU
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. O43819
Target/Protein SCO2
Species of origin Homo sapiens (Human)
AA Sequence PAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
Protein description Full length of mature protein
MW of Fusion Proten 41.1 kDa
Expression Region 43-266aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-SUMO-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Protein SCO2 homolog, mitochondrial(SCO2)
Your Rating