*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human SARS coronavirus Spike glycoprotein(S) ,partial

As low as $1,600.00
In stock
Product Code
CSB-YP348663HQEa4
Product Code: CSB-YP348663HQEa4
Size: 20μg/100μg/1mg
Species of origin: Homo sapiens (Human)
Express system: Yeast
More Information
Uniprot NO. P59594
Target/Protein SARS-COV-RBD
Species of origin Homo sapiens (Human)
AA Sequence RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Protein description Extracellular Domain
MW of Fusion Proten In development
Expression Region 306-527aa
Expression System Yeast
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-sumostar-tagged
Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Endotoxin Not test.

Write Your Own Review
You're reviewing:Recombinant Human SARS coronavirus Spike glycoprotein(S) ,partial
Your Rating