Recombinant Human Novel Coronavirus Spike glycoprotein(S) (W436R), partial

As low as $225.00
In stock
Product Code
CSB-MP3324GMY1(M2)
Product Code: CSB-MP3324GMY1(M2)
Size: 20μg/100μg/1mg
Species of origin: SARS-CoV-2
Express system: Mammalian cell
More Information
Uniprot NO. P0DTC2
Target/Protein S,S1-RBD
Species of origin SARS-CoV-2
AA Sequence RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIARNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Protein description Partial
MW of Fusion Proten 30.2 kDa
Expression Region 319-541aa (W436R)
Expression System Mammalian Cell
Purity Greater than 90% as determined by SDS-PAGE.
Tag info C-terminal 10xHis-tagged
Buffer Lyophilized from a 0.2 λm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Endotoxin Not test.

Write Your Own Review
You're reviewing:Recombinant Human Novel Coronavirus Spike glycoprotein(S) (W436R), partial
Your Rating