Recombinant Human Novel Coronavirus Spike glycoprotein(S), partial

As low as $380.00
In stock
Product Code
CSB-YP3324GMY2
Product Code: CSB-YP3324GMY2
Size: 100μg/1mg
Species of origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Express system: Yeast
More Information
Uniprot NO. P0DTC2
Target/Protein S
Species of origin Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
AA Sequence VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNF
Protein description Partial
MW of Fusion Proten 93.2 kDa
Expression Region 16-318aa
Expression System Yeast
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-PDI-tagged
Buffer Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0
Endotoxin Not test.

Write Your Own Review
You're reviewing:Recombinant Human Novel Coronavirus Spike glycoprotein(S), partial
Your Rating