*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active)

As low as $225.00
In stock
Product Code
CSB-MP3324GMY1(M6)k2
Product Code: CSB-MP3324GMY1(M6)k2
Size: 20μg/100μg/1mg
Species of origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Express system: Mammalian Cell
More Information
Uniprot NO. P0DTC2
Target/Protein S
Species of origin Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
AA Sequence RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Protein description Partial
MW of Fusion Proten 55.3kDa
Expression Region 319-541aa(N501Y)
Expression System Mammalian Cell
Purity Greater than 90% as determined by SDS-PAGE.
Tag info C-terminal 6xHis-mFC-tagged
Buffer Lyophilized from a 0.2 λm sterile filtered PBS, 6% Trehalose, pH 7.4.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.

Write Your Own Review
You're reviewing:Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active)
Your Rating