*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon
Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active)
As low as
$225.00
In stock
Product Code
CSB-MP3324GMY1(M6)k2
Product Code: CSB-MP3324GMY1(M6)k2
Size: 20μg/100μg/1mg
Species of origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Express system: Mammalian Cell
Size: 20μg/100μg/1mg
Species of origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Express system: Mammalian Cell
| Uniprot NO. | P0DTC2 |
|---|---|
| Target/Protein | S |
| Species of origin | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| AA Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Protein description | Partial |
| MW of Fusion Proten | 55.3kDa |
| Expression Region | 319-541aa(N501Y) |
| Expression System | Mammalian Cell |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Tag info | C-terminal 6xHis-mFC-tagged |
| Buffer | Lyophilized from a 0.2 λm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Write Your Own Review
Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active) Images
