Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)

$312.00
In stock
Product Code
CSB-MP019135MO
Product Inquiry
Product Code: CSB-MP019135MO
Size: 10μg/50μg/100μg/200μg
Species of origin: Mus musculus (Mouse)
Application: SDS-PAGE
Express system: Mammalian cell
More Information
Alternative names Glutaminyl cyclase Short name:QC
Uniprot NO. Q9CYK2
Target/Protein Qpct
Species of origin Mus musculus (Mouse)
AA Sequence AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
Biologically Active Not Test
Nature Recombinant
Protein description Full Length of Mature Protein
MW of Fusion Proten 41.6 kDa
Expression Region 36-362aa
Expression System Mammalian Cell
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Relevance Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity).
Research areas Neuroscience

Write Your Own Review
You're reviewing:Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)
Your Rating