Recombinant Human Pregnancy zone protein(PZP),partial

$154.00
In stock
Product Code
CSB-EP019131HU
Product Inquiry
Product Code: CSB-EP019131HU
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Application: SDS-PAGE
Express system: E.coli
More Information
Alternative names C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6
Uniprot NO. P20742
Target/Protein PZP
Species of origin Homo sapiens (Human)
AA Sequence MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASGANVSEQLSLKLPSNVVKESARASFSVLGDILGSAMQNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFG
Biologically Active Not Test
Nature Recombinant
Protein length Partial of Isoform 2
MW of Fusion Proten 42.3 kDa
Expression Region 472-821aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Relevance Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme rains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.
Research areas Neuroscience

Write Your Own Review
You're reviewing:Recombinant Human Pregnancy zone protein(PZP),partial
Your Rating