Recombinant Human Platelet-derived Growth Factor-BB(PDGFB),partial (Active) (GMP)

$134.00
In stock
Product Code
CSB-AP005941HU
Product Inquiry
Product Code: CSB-AP005941HU
Size: 5μg/100μg/1mg
Species of origin: Homo sapiens (Human)
Express system: E.Coli
More Information
Alternative names PDGF subunit B PDGF-2 Platelet-derived growth factor B chain Platelet-derived growth factor beta polypeptide Proto-oncogene c-Sis INN: Becaplermin
Uniprot NO. P01127
Target/Protein PDGFB
Species of origin Homo sapiens (Human)
AA Sequence M+SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPV
Activity Data Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 3 ng/ml, corresponding to a specific activity of > 3.3 Χ 105 IU/mg.
Protein description Partial
MW of Fusion Proten 12.4kDa
Expression Region 82-190aa
Expression System E.coli
Purity > 98 % by SDS-PAGE and HPLC analyses.
Tag info Tag-Free
Storage Lyophilized from a 0.2 λm filtered concentrated solution in PBS, pH 7.4.
Relevance Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin . Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA
Research areas Cancer

Write Your Own Review
You're reviewing:Recombinant Human Platelet-derived Growth Factor-BB(PDGFB),partial (Active) (GMP)
Your Rating