*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Rat Oncostatin-M(Osm)

As low as $368.00
In stock
Product Code
CSB-YP723970RA
Product Code: CSB-YP723970RA
Size: 10μg/100μg/500μg
Species: Rattus norvegicus (Rat)
Express system: Yeast
More Information
Uniprot NO. Q65Z15
Target/Protein Osm
Species of origin Rattus norvegicus (Rat)
AA Sequence KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
Protein description Full length of mature protein
MW of Fusion Proten 22.6 kDa
Expression Region 26-208aa
Expression System Yeast
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Rat Oncostatin-M(Osm)
Your Rating