*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Rat Oncostatin-M(Osm)

As low as $660.00
In stock
Product Code
CSB-MP723970RA
Product Code: CSB-MP723970RA
Size: 20μg/100μg
Species: Rattus norvegicus (Rat)
Express system: Mammalian Cell
More Information
Alternative names Osm; Oncostatin-M; OSM
Uniprot NO. Q65Z15
Target/Protein Osm
Species of origin Rattus norvegicus (Rat)
AA Sequence KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
Protein description Full length of mature protein
MW of Fusion Proten 24.2 kDa
Expression Region 26-208aa
Expression System Mammalian Cell
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 10xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Rat Oncostatin-M(Osm)
Your Rating