*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon
Recombinant Rat Oncostatin-M(Osm)
As low as
$660.00
In stock
Product Code
CSB-MP723970RA
Product Code: CSB-MP723970RA
Size: 20μg/100μg
Species: Rattus norvegicus (Rat)
Express system: Mammalian Cell
Size: 20μg/100μg
Species: Rattus norvegicus (Rat)
Express system: Mammalian Cell
| Alternative names | Osm; Oncostatin-M; OSM |
|---|---|
| Uniprot NO. | Q65Z15 |
| Target/Protein | Osm |
| Species of origin | Rattus norvegicus (Rat) |
| AA Sequence | KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR |
| Protein description | Full length of mature protein |
| MW of Fusion Proten | 24.2 kDa |
| Expression Region | 26-208aa |
| Expression System | Mammalian Cell |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Tag info | N-terminal 10xHis-tagged |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Write Your Own Review
Recombinant Rat Oncostatin-M(Osm) Images
