*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9(nsp9)

As low as $396.00
In stock
Product Code
CSB-MP3388GND
Product Code: CSB-MP3388GND
Size: 20μg/100μg/500μg
Species of origin: Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)
Express system: Mammalian cell
More Information
Uniprot NO. P0DTD1/YP_009742616.1
Target/Protein Nsp9
Species of origin Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)
AA Sequence NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Protein description Full Length
MW of Fusion Proten 44.5 kDa
Expression Region 1-113aa
Expression System Mammalian Cell
Purity Greater than 90% as determined by SDS-PAGE.
Tag info C-terminal hFc-Flag-tagged
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Not test.

Write Your Own Review
You're reviewing:Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9(nsp9)
Your Rating