*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon
Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9(nsp9)
As low as
$212.00
In stock
Product Code
CSB-EP3388GND
Product Code: CSB-EP3388GND
Size: 20μg/100μg/1mg
Species of origin: Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)
Express system: E.coli
Size: 20μg/100μg/1mg
Species of origin: Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)
Express system: E.coli
| Uniprot NO. | P0DTD1/YP_009742616.1 |
|---|---|
| Target/Protein | Nsp9 |
| Species of origin | Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV) |
| AA Sequence | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Protein description | Full Length |
| MW of Fusion Proten | 13.9 kDa |
| Expression Region | 1-113aa |
| Expression System | E.coli |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Tag info | C-terminal 10xHis-tagged |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Endotoxin | Not test. |
Write Your Own Review
Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9(nsp9) Images
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Predicted band size: 13.9 kDa
Observed band size: 15 kDa due to molecular structure of protein