Recombinant Rat Beta-nerve growth factor(Ngf)

As low as $306.00
In stock
Product Code
CSB-YP015779RA
Product Code: CSB-YP015779RA
Size: 20μg/100μg/500μg
Species: Rattus norvegicus (Rat)
Express system: Yeast
More Information
Uniprot NO. P25427
Target/Protein Ngf
Species of origin Rattus norvegicus (Rat)
AA Sequence SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG
Protein description Full length of mature protein
MW of Fusion Proten 15.4 kDa
Expression Region 122-241aa
Expression System Yeast
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Rat Beta-nerve growth factor(Ngf)
Your Rating