Recombinant Rotavirus A Outer capsid glycoprotein VP7

$235.00
In stock
Product Code
CSB-EP420195RIU
Product Inquiry
Product Code: CSB-EP420195RIU
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) (RV-A)
Application: SDS-PAGE
Express system: E.coli
More Information
Uniprot NO. A8D8S8
Target/Protein N/A
Species of origin Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) (RV-A)
AA Sequence QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQIIQTMSKRSRSLNSSAFYYRV
Biologically Active Not Test
Nature Recombinant
Protein description Full Length of Mature Protein
MW of Fusion Proten 36.0 kDa
Expression Region 34-309aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "Nucleotide sequence of the structural glycoprotein VP7 gene of C486 G6P[5] Bovine rotavirus." Gonzalez D.D., Mozgovoj M.V., Bellido D., Parreno V.G., Wigdorovitz A., Dus Santos M.J.
Relevance Outer capsid protein involved in attachment and possibly entry into the host epithelial cell. It is subsequently lost, together with VP4, following virus entry into the host cell. The outer layer contains 780 copies of VP7, grouped as 260 trimers. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. In integrin-dependent strains, VP7 seems to essentially target the integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3 at a postbinding stage, once the initial attachment by VP4 has been achieved
Research areas Others

Write Your Own Review
You're reviewing:Recombinant Rotavirus A Outer capsid glycoprotein VP7
Your Rating