Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

$289.00
In stock
Product Code
CSB-EP357829TIF
Product Inquiry
Product Code: CSB-EP357829TIF
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
Application: SDS-PAGE
Express system: E.coli
More Information
Uniprot NO. P09989
Target/Protein N/A
Species of origin Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
AA Sequence DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Biologically Active Not Test
Nature Recombinant
Protein length Full Length of Mature Protein
MW of Fusion Proten 43.1 kDa
Expression Region 24-270aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-SUMO-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference Cloning of trichosanthin cDNA and its expression in Escherichia coli.Shaw P.C., Yung M.H., Zhu R.H., Ho W.K.K., Ng T.B., Yeung H.W.Gene 97:267-272(1991)
Relevance Inactivates eukaryotic 60S ribosomal subunits.
Research areas Others

Write Your Own Review
You're reviewing:Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin
Your Rating