Recombinant Ambrosia artemisiifolia Pectate lyase 5

$298.00
In stock
Product Code
CSB-EP329754BYC
Product Inquiry
Product Code: CSB-EP329754BYC
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Ambrosia artemisiifolia (Short ragweed)
Application: SDS-PAGE
Express system: E.coli
More Information
Uniprot NO. P27759
Target/Protein N/A
Species of origin Ambrosia artemisiifolia (Short ragweed)
AA Sequence AEDLQEILPVNETRRLTTSGAYNIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAGFTLNGVKNVIIHNINMHDVKVNPGGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQVVNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHGEAAAESMKWNWRTNKDVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC
Biologically Active Not Test
Nature Recombinant
Protein description Full Length of Mature Protein
MW of Fusion Proten 55.8 kDa
Expression Region 26-396aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-SUMO-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference Cloning of Amb a I (antigen E),the major allergen family of short ragweed pollen.Rafnar T., Griffith I.J., Kuo M.-C., Bond J.F., Rogers B.L., Klapper D.G.J. Biol. Chem. 266:1229-1236(1991)
Relevance Has pectate lyase activity.
Research areas Others

Write Your Own Review
You're reviewing:Recombinant Ambrosia artemisiifolia Pectate lyase 5
Your Rating