Recombinant Mouse Myoglobin(Mb)

$412.00
In stock
Product Code
CSB-MP013529MO
Product Inquiry
Product Code: CSB-MP013529MO
Size: 10μg/50μg/100μg/200μg
Species of origin: Mus musculus (Mouse)
Application: SDS-PAGE
Express system: Mammalian cell
More Information
Uniprot NO. P04247
Target/Protein Mb
Species of origin Mus musculus (Mouse)
AA Sequence GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Biologically Active Not Test
Nature Recombinant
Protein description Full Length of Mature Protein
MW of Fusion Proten 21.9 kDa
Expression Region 2-154aa
Expression System Mammalian Cell
Purity Greater than 85% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "The mouse myoglobin gene. Characterisation and sequence comparison with other mammalian myoglobin genes." Blanchetot A., Price M., Jeffreys A.J. Eur. J. Biochem. 159:469-474(1986)
Relevance Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Research areas Cancer

Write Your Own Review
You're reviewing:Recombinant Mouse Myoglobin(Mb)
Your Rating