*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Mouse Lymphotoxin-alpha(Lta)

As low as $306.00
In stock
Product Code
CSB-EP013218MOa0
Product Code: CSB-EP013218MOa0
Size: 20μg/100μg/1mg
Species: Mus musculus (Mouse)
Express system: E.coli
More Information
Uniprot NO. P09225
Target/Protein Lta
Species of origin Mus musculus (Mouse)
AA Sequence LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL
Protein description Full length of mature protein
MW of Fusion Proten 23.8 kDa
Expression Region 34-202aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Mouse Lymphotoxin-alpha(Lta)
Your Rating