Recombinant Human Lysyl oxidase homolog 3(LOXL3),partial

As low as $306.00
In stock
Product Code
CSB-EP013042HU1
Product Code: CSB-EP013042HU1
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. P58215
Target/Protein LOXL3
Species of origin Homo sapiens (Human)
AA Sequence DRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVHNCHIGDAFSEEANRRFERYPGQTSNQII
Protein description Partial
MW of Fusion Proten 55.7 kDa
Expression Region 401-608aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-GST-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Lysyl oxidase homolog 3(LOXL3),partial
Your Rating