*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Shigella flexneri Invasin IpaD(IpaD)

As low as $388.00
In stock
Product Code
CSB-EP325954SZB
Product Code: CSB-EP325954SZB
Size: 20μg/100μg/1mg
Species: Shigella flexneri
Express system: E.coli
More Information
Uniprot NO. P18013
Target/Protein ipaD
Species of origin Shigella flexneri
AA Sequence MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDTLHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINMTPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF
Protein description Full Length
MW of Fusion Proten 56.6 kDa
Expression Region 1-332aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Shigella flexneri Invasin IpaD(IpaD)
Your Rating