*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Interleukin-9(IL9)

As low as $712.00
In stock
Product Code
CSB-EP011675HU
Product Code: CSB-EP011675HU
Size: 20μg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. P15248
Target/Protein IL9
Species of origin Homo sapiens (Human)
AA Sequence QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIP SDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGN ALTFLKSLLEIFQKEKMRGMRGKI
Protein description Full length of mature protein
MW of Fusion Proten Inquire
Expression Region 19-144
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info The tag type will be determined during production process.

Write Your Own Review
You're reviewing:Recombinant Human Interleukin-9(IL9)
Your Rating