Recombinant Mouse Interleukin-7(Il7)

As low as $195.00
In stock
Product Code
CSB-AP004791MO
Product Inquiry
Product Code: CSB-AP004791MO
Size: 10μg/50μg/500μg/1mg
Species of origin: Mus musculus (Mouse)
Express system: Mammalian cell
More Information
Alternative names IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoietin -1; PBGF
Uniprot NO. P10168
Target/Protein Il7
Species of origin Mus musculus (Mouse)
AA Sequence ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Activity Data The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is less than 5 ng/ml.
Protein description Full length of mature protein
MW of Fusion Proten 15.9 kDa
Expression Region 26-154aa
Expression System Mammalian Cell
Purity Greater than 95% as determined by SDS-PAGE.
Tag info C-terminal 6xHis-tagged
Storage Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Relevance Mouse interleukin-7(IL-7) is the member of hemopoietin family which is important to the differentiation, proliferation, and survival of lymphocyte. Mouse IL-7 shares approximately 88% aa sequence identity with rat IL-7 and 58-60% with human, equine, bovine, ovine, porcine, feline and canine IL-7. It is widely expressed in primary and secondary lymphoid tissues cell and stromal epithelial cells of the thymus, bone marrow, and intestines. IL-7 activation of IL-7 R alpha is critical for both T cell and B cell lineage development. It is important for proliferation during certain stages of B-cell maturation. IL-7 contributes to the maintenance of all na?ve and memory T cells, mainly by promoting expression of the anti-apoptotic protein Bcl-2. It is required for optimal T cell-dendritic cell interaction.
Research areas Immunology

Write Your Own Review
You're reviewing:Recombinant Mouse Interleukin-7(Il7)
Your Rating