Recombinant Mouse Interleukin-33(Il33),partial

As low as $137.00
In stock
Product Code
CSB-AP004251MO
Product Code: CSB-AP004251MO
Size: 10μg/50μg/500μg/1mg
Species of origin: Mus musculus (Mouse)
Express system: E.coli
More Information
Alternative names Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Interleukin-1 family member 11; DVS27; NF-HEV and IL- 1F11
Uniprot NO. Q8BVZ5
Target/Protein Il33
Species of origin Mus musculus (Mouse)
AA Sequence SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Activity Data The activity is as determined by its binding ability in a functional ELISA. Immobilized recombinant mouse IL33 at 5 μg/mL can bind mouse IL1RL1 with a linear range of 0.625-5ug/ml.
Protein description Partial
MW of Fusion Proten 17.6 kDa
Expression Region 109-266aa
Expression System E.coli
Purity Greater than 95% as determined by SDS-PAGE.
Tag info Tag-Free
Storage Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Relevance Mouse Interleukin 33 (IL-33) is a 30 kDa proinflammatory cytokine which may also regulates gene transcription in producer cells. IL-33 is constitutively expressed in smooth muscle and airway epithelia. IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. It is up?regulated in arterial smooth muscle, dermal fibroblasts, and keratinocytes following IL-1 alpha or IL?1 beta stimulation. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and also leads to severe pathological changes in mucosal organs.
Research areas Immunology

Write Your Own Review
You're reviewing:Recombinant Mouse Interleukin-33(Il33),partial
Your Rating