Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha(IL15 & IL15RA)

As low as $137.00
In stock
Product Code
CSB-AP004671HU
Product Inquiry
Product Code: CSB-AP004671HU
Size: 10μg/50μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Express system: Mammalian cell
More Information
Alternative names IL15RA&IL15;Interleukin-15; IL-15; IL15;IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha
Uniprot NO. Q13261 & P40933
Target/Protein IL15 & IL15RA
Species of origin Homo sapiens (Human)
AA Sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGD ASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Activity Data The ED50 as determined in a cell proliferation assay using CTLL?2 mouse cytotoxic T cells is less than 20 ng/ml.
Protein description Heterodimer
MW of Fusion Proten 46.9 kDa
Expression Region 31-96aa & 49-162aa
Expression System Mammalian Cell
Purity Greater than 95% as determined by SDS-PAGE.
Tag info C-terminal FC-tagged
Storage Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Relevance IL15RA is a high-affinity receptor for interleukin-15. Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide variety of Tand B cells and non-lymphoid cells.IL-15 is a cytokine that regulates T cell and natural killer cell activation and proliferation. IL-15 binds to the alpha subunit of the IL-15RA with high affinity. IL-15 also binds to the beta and gamma chains of the IL-2 receptor, but not the alpha subunit of the IL2 receptor. IL-15 is structurally and functionally related to IL-2. Both cytokines share some subunits of receptors, allowing them to compete for and negatively regulate each other's activity. The number of CD8+ memory T cells is controlled by a balance between IL-15 and IL-2. Despite their many overlapping functional properties, IL-2 and IL-15 are, in fact, quite distinct players in the immune system. IL-15 is constitutively expressed by a wide variety of cell types and tissues, including monocytes, macrophages and DCs.
Research areas Cancer

Write Your Own Review
You're reviewing:Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha(IL15 & IL15RA)
Your Rating