Recombinant Mouse Interleukin-10(Il10)

As low as $195.00
In stock
Product Code
CSB-AP004841MO
Product Code: CSB-AP004841MO
Size: 10μg/50μg/500μg/1mg
Species of origin: Mus musculus (Mouse)
Express system: E.coli
More Information
Alternative names Interleukin-10;Il10;IL-10;Cytokine synthesis inhibitory factor;CSIF;
Uniprot NO. P18893
Target/Protein Il10
Species of origin Mus musculus (Mouse)
AA Sequence SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Activity Data The ED50 as determined by the dose-dependent co-stimulation with murine IL-4 of MC-9 cells is less than 2 ng/ml.
Protein description Full length of mature protein
MW of Fusion Proten 18.9 kDa
Expression Region 19-178aa
Expression System E.coli
Purity Greater than 95% as determined by SDS-PAGE.
Tag info Tag-Free
Storage Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Relevance Mouse Il10 is the prototypic member of the IL-10 cytokine family, including IL-10, IL-19, IL-20, IL-22 (IL-TIF), IL-24 and IL-26. Many viruses encode viral members of the IL-10 family, such as Epstein-Barr virus (EBV) and human cytomegalovirus (HCMV).Its main function is inhibiting the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Although human and mouse IL-10 are 81% identical at the nucleotide and amino acid level, mouse IL-10 is species-specific and does not act on human cells. Interestingly, Human IL-10 is active on mouse cells.
Research areas Immunology

Write Your Own Review
You're reviewing:Recombinant Mouse Interleukin-10(Il10)
Your Rating