Recombinant Human Interleukin-23(IL-23)

As low as $195.00
In stock
Product Code
CSB-AP004661HU
Product Code: CSB-AP004661HU
Size: 10μg/50μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Express system: Mammalian cell
More Information
Alternative names SGRF;IL-23p19;CLMF p40;IL-12 subunit p40;NKSF2
Uniprot NO. Q9NPF7 & P29460
Target/Protein IL-23
Species of origin Homo sapiens (Human)
AA Sequence RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIW STDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Activity Data The ED50 as determined by its ability to binding IL23RA used funtional ELISA is less than 20 ug/ml
Protein description Heterodimer
MW of Fusion Proten 54.4 kDa
Expression Region 20-189aa & 23-328aa
Expression System Mammalian Cell
Purity Greater than 95% as determined by SDS-PAGE.
Tag info C-terminal 6xHis-tagged
Storage Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Relevance Interleukin 23 (IL-23) is a heterodimeric cytokine composed of two disulfide-linked subunits, a p19 subunit that is unique to IL-23, and a p40 subunit that is shared with IL-12. The p19 subunit has homology to the p35 subunit of IL-12, as well as to other single chain cytokines such as IL-6 and IL-11. The p40 subunit is homologous to the extracellular domains of the hematopoietic cytokine receptors. Although p19 is expressed by activated macrophages, dendritic cells, T cells, and endothelial cells, only activated macrophages and dendritic cells express p40 concurrently to produce IL-23. IL-23 has biological activities that are similar to, but distinct from IL-12. Both IL-12 and IL-23 induce proliferation and IFN-gamma production by human T cells. While IL-12 acts on both naive and memory human T cells, the effects of IL-23 is restricted to memory T cells.
Research areas Immunology

Write Your Own Review
You're reviewing:Recombinant Human Interleukin-23(IL-23)
Your Rating