*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Immunoglobulin lambda-like polypeptide 5(IGLL5)

As low as $250.00
In stock
Product Code
CSB-YP494948HU
Product Code: CSB-YP494948HU
Size: 20μg/100μg/500μg
Species: Homo sapiens (Human)
Express system: Yeast
More Information
Uniprot NO. B9A064
Target/Protein IGLL5
Species of origin Homo sapiens (Human)
AA Sequence HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Protein description Full length of mature protein
MW of Fusion Proten 21.3 kDa
Expression Region 36-214aa
Expression System Yeast
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Immunoglobulin lambda-like polypeptide 5(IGLL5)
Your Rating