Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase(icaB)

As low as $298.00
In stock
Product Code
CSB-EP751939SKY
Product Code: CSB-EP751939SKY
Size: 10μg/200μg
Species: Staphylococcus aureus (strain N315)
Express system: E.coli
More Information
Alternative names Biofilm polysaccharide intercellular adhesin deacetylase Short name: Biofilm PIA deacetylase Intercellular adhesion protein B
Uniprot NO. Q7A349
Target/Protein icaB
Species of origin Staphylococcus aureus (strain N315)
AA Sequence NADDDSPKKLKYKENSALALNYHRVRKANFLNNFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINFDDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFETHTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPVIKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD
Protein description Full length of mature protein
MW of Fusion Proten 35.9 kDa
Expression Region 29-290aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase(icaB)
Your Rating