Recombinant Human Neuroserpin protein(SERPINI1) (Active)

As low as $142.00
In stock
Product Code
CSB-AP000141HU
Product Code: CSB-AP000141HU
Size: 5μg/100μg/500μg
Species of origin: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. Q99574
Target/Protein SERPINI1,PI12
Species of origin Homo sapiens (Human)
AA Sequence TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Activity Data Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat C6 cells is less than 0.5 λg/ml, corresponding to a specific activity of > 2000 IU/mg.
Protein description Full length of mature protein
MW of Fusion Proten 44.7 kDa
Expression Region 17-410aa
Expression System E.coli
Purity >95% as determined by SDS-PAGE and HPLC.
Tag info Tag-Free
Buffer Lyophilized from a 0.2 λm filtered PBS, pH 7.5,
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Research areas Neuroscience

Write Your Own Review
You're reviewing:Recombinant Human Neuroserpin protein(SERPINI1) (Active)
Your Rating