Recombinant Human Endothelin-1 receptor(EDNRA)

As low as $741.00
In stock
Product Code
CSB-CF007403HU
Product Inquiry
Product Code: CSB-CF007403HU
Size: 10μg/50μg/100μg
Species of origin: Homo sapiens (Human)
Application: SDS-PAGE
Express system: in vitro E.coli
More Information
Alternative names Endothelin A receptor
Uniprot NO. P25101
Target/Protein EDNRA
Species of origin Homo sapiens (Human)
AA Sequence DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Biologically Active Not Test
Nature Recombinant
Protein description Full Length of Mature Protein
MW of Fusion Proten 48.5 kDa
Expression Region 21�C427aa
Expression System In vitro E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info C-terminal 10xHis-tagged
Buffer Tris-based buffer, 50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.function=Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenge
Reference "Molecular cloning of human endothelin receptors and their expression in vascular endothelial cells and smooth muscle cells."Arai H., Nakao K., Hosoda K., Ogawa Y., Nakagawa O., Komatsu Y., Imura H.Jpn. Circ. J. 56:1303-1307(1992)
Relevance Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
Research areas Signal Transduction

Write Your Own Review
You're reviewing:Recombinant Human Endothelin-1 receptor(EDNRA)
Your Rating