Recombinant Human ATP-sensitive inward rectifier potassium channel 10(KCNJ10)

$719.00
In stock
Product Code
CSB-CF012048HU
Product Inquiry
Product Code: CSB-CF012048HU
Size: 10μg/50μg/100μg
Species of origin: Homo sapiens (Human)
Application: SDS-PAGE
Express system: in vitro E.coli
More Information
Alternative names ATP-dependent inwardly rectifying potassium channel Kir4.1; Inward rectifier K(+) channel Kir1.2; Potassium channel, inwardly rectifying subfamily J member 10
Uniprot NO. P78508
Target/Protein KCNJ10
Species of origin Homo sapiens (Human)
AA Sequence MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Biologically Active Not Test
Nature Recombinant
Protein description Full Length
MW of Fusion Proten 58.5 kDa
Expression Region 1-379aa
Expression System In vitro E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-SUMO-tagged
Buffer Tris-based buffer, 50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.function=May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a
Reference "Co-expression of human Kir3 subunits can yield channels with different functional properties."Schoots O., Wilson J.M., Ethier N., Bigras E., Hebert T.E., Van Tol H.H.M.Cell. Signal. 11:871-883(1999)
Relevance May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity). In the kidney, together with KCNJ16, mediates basolateral K+ recycling in distal tubules; this process is critical for Na+ reabsorption at the tubules
Research areas Neuroscience

Write Your Own Review
You're reviewing:Recombinant Human ATP-sensitive inward rectifier potassium channel 10(KCNJ10)
Your Rating