Recombinant Human 5-hydroxytryptamine receptor 3E(HTR3E),partial

As low as $838.00
In stock
Product Code
CSB-CF010894HU
Product Code: CSB-CF010894HU
Size: 20μg/100μg
Species: Homo sapiens (Human)
Express system: In Vitro E.coli
More Information
Alternative names Serotonin receptor 3E
Uniprot NO. A5X5Y0
Target/Protein HTR3E
Species of origin Homo sapiens (Human)
AA Sequence MSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT
Protein description Partial
MW of Fusion Proten 58.2 kDa
Expression Region 72-228aa&241-456aa
Expression System In vitro E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-SUMO-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human 5-hydroxytryptamine receptor 3E(HTR3E),partial
Your Rating