Recombinant Rat Hemopexin(Hpx)

$235.00
In stock
Product Code
CSB-EP010723RA
Product Inquiry
Product Code: CSB-EP010723RA
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Rattus norvegicus (Rat)
Application: SDS-PAGE
Express system: E.coli
More Information
Uniprot NO. P20059
Target/Protein Hpx
Species of origin Rattus norvegicus (Rat)
AA Sequence NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ
Biologically Active Not Test
Nature Recombinant
Protein description Full Length of Mature Protein
MW of Fusion Proten 52.9 kDa
Expression Region 24-460aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference Rat hemopexin. Molecular cloning, primary structural characterization, and analysis of gene expression.Nikkilae H., Gitlin J.D., Mueller-Eberhard U.Biochemistry 30:823-829(1991)
Relevance Binds he and transports it to the liver for breakdown and iron recovery, after which the free hopexin returns to the circulation.
Research areas Others

Write Your Own Review
You're reviewing:Recombinant Rat Hemopexin(Hpx)
Your Rating