*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human HLA class II histocompatibility antigen, DM beta chain(HLA-DMB),partial

As low as $388.00
In stock
Product Code
CSB-EP333326HU
Product Code: CSB-EP333326HU
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. P28068
Target/Protein HLA-DMB
Species of origin Homo sapiens (Human)
AA Sequence GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK
Protein description Partial
MW of Fusion Proten 26.4 kDa
Expression Region 19-218aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human HLA class II histocompatibility antigen, DM beta chain(HLA-DMB),partial
Your Rating