*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon
Recombinant Human HLA class II histocompatibility antigen, DM beta chain(HLA-DMB),partial
As low as
$388.00
In stock
Product Code
CSB-EP333326HU
Product Code: CSB-EP333326HU
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
| Uniprot NO. | P28068 |
|---|---|
| Target/Protein | HLA-DMB |
| Species of origin | Homo sapiens (Human) |
| AA Sequence | GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK |
| Protein description | Partial |
| MW of Fusion Proten | 26.4 kDa |
| Expression Region | 19-218aa |
| Expression System | E.coli |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Tag info | N-terminal 6xHis-tagged |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Write Your Own Review
Recombinant Human HLA class II histocompatibility antigen, DM beta chain(HLA-DMB),partial Images
