*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Glutaminase kidney isoform, mitochondrial(GLS),partial

As low as $306.00
In stock
Product Code
CSB-EP009528HU(F1)
Product Code: CSB-EP009528HU(F1)
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. O94925
Target/Protein GLS
Species of origin Homo sapiens (Human)
AA Sequence KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Protein description Partial
MW of Fusion Proten 33.3 kDa
Expression Region 616-669aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal GST-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Glutaminase kidney isoform, mitochondrial(GLS),partial
Your Rating