*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon
Uniprot NO. | O94925 |
---|---|
Target/Protein | GLS |
Species of origin | Homo sapiens (Human) |
AA Sequence | KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL |
Protein description | Partial |
MW of Fusion Proten | 33.3 kDa |
Expression Region | 616-669aa |
Expression System | E.coli |
Purity | Greater than 90% as determined by SDS-PAGE. |
Tag info | N-terminal GST-tagged |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |